PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy008934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 518aa    MW: 56364.5 Da    PI: 4.9497
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59541404PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.62.1e-1131465182374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++L+ecA  +s+ +  +a++ L++l++ +s++g+p+qR+ +yf+eAL ++l+    +    a+   +++ ++s+e +  +k++++++P+ kf+hltaNq
  Ahy008934 146 LKALTECAL-LSETEPDQASESLSQLRKSVSQNGNPIQRVSFYFAEALTRKLTFeREKDKNLAMVEAASTATTSEELTLCYKALNDACPYSKFAHLTANQ 244
                6899****8.67779999**********************************983333444445566666677999999********************* PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                aIlea+eg++r+Hi+Df+i qG+QW+aLlqa+a+R++g+p s+Ri g+ +++ g   + +l++tg+rL++fA+ l+++fef++ + + +++l+ +++ v+
  Ahy008934 245 AILEATEGASRIHIVDFGIVQGIQWAALLQAFATRSSGKPeSIRISGIPAMALGtsPAASLSATGNRLSEFAKLLELNFEFRP-ILTPIHELNESSFCVD 343
                ************************************77776*********99889999*************************.799************* PP

       GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                p+EalaVn++lql++llde+ +  +   + L+l ksl+Pk+v++ e ea+++++ F++rf +al+yys++f+sle +++++s er+ vEr+l+gr+i+ v
  Ahy008934 344 PNEALAVNFMLQLYNLLDETPDAVE---AALRLAKSLRPKIVTLGEYEASLTRGGFMNRFKNALRYYSSVFESLEPNMAPDSPERMQVERHLFGRRISGV 440
                *****************99999998...9*********************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                v   g+  rer+e +e+Wr  +e++GF++v+ls++a +qak ll +++ s  y++ e++ +++ l Wkd pL++vS+Wr
  Ahy008934 441 VGLPGTV-RERMEDKEQWRVFMESCGFESVSLSHYAISQAKILLWNYSySSLYSLVESKPEFLsLAWKDVPLLTVSSWR 518
                ******9.9***************************************9999******999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.295119496IPR005202Transcription factor GRAS
PfamPF035147.4E-111146518IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
XATFDSDEWM DTLMATAAGD STDTSTIPAA AAAWHNGNSD FGLYGSSPFT TCPTRLSPTS  60
DLNRVIFSSE PHTAAVTTTA AATGVSLQQA QLPATWATPP PLPPPTAVKE APKMVASSPP  120
APPQAPATVQ GGFSSLPEPD SSHPLLKALT ECALLSETEP DQASESLSQL RKSVSQNGNP  180
IQRVSFYFAE ALTRKLTFER EKDKNLAMVE AASTATTSEE LTLCYKALND ACPYSKFAHL  240
TANQAILEAT EGASRIHIVD FGIVQGIQWA ALLQAFATRS SGKPESIRIS GIPAMALGTS  300
PAASLSATGN RLSEFAKLLE LNFEFRPILT PIHELNESSF CVDPNEALAV NFMLQLYNLL  360
DETPDAVEAA LRLAKSLRPK IVTLGEYEAS LTRGGFMNRF KNALRYYSSV FESLEPNMAP  420
DSPERMQVER HLFGRRISGV VGLPGTVRER MEDKEQWRVF MESCGFESVS LSHYAISQAK  480
ILLWNYSYSS LYSLVESKPE FLSLAWKDVP LLTVSSWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1491425181375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015952823.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLA0A067KR640.0A0A067KR64_JATCU; GRAS22 protein
STRINGPOPTR_0005s12520.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-165GRAS family protein